Here we're going to tell you about vegan food, food of animal origin, explain the necessity of animal protein consumption, and demystify other aspects of daily nutrition to help you live a healthier, better, happier life, change your food style, and save your money.
Follow our posts on the website and social media!
![](https://static.wixstatic.com/media/04b6fe_e6e8fccb9c494be4bf505706116c165a~mv2.png/v1/fill/w_49,h_28,al_c,q_85,usm_0.66_1.00_0.01,blur_2,enc_auto/04b6fe_e6e8fccb9c494be4bf505706116c165a~mv2.png)
Rare food is a startup combining seed and toxic assets dedicated to planted meat and milk products production that's integrated with its impossible food retail chain. Our food production and retail business are supported by end-to-end integrated circular food plastic solutions. At the moment, we are developing in Russia and in UK three projects: @HappyTurtle, @VisionCocktailHall, Ginnger and @SantaFe. The ground base for all projects is planted food, healthy recipes, elimination of health-damaging components, smart packaging, and no alcohol.
#rarefood #impossiblefood #plantedmeat #healthyjunkfood #veganonthego #happyturtle #visioncocktailhall #santafe #plantedmeat #plantedmilk #casualfood #dispensibleveganfood #hasheight #boost #raevskayarepninaannamariaserafima #аннамариясерафимараевскаярепнина #startedinoxford #oxfordbusinessalumni #oxfordsbs #moscow #london #russia #uk #raevskayarepninaannamariaserafimasergeevna #raevskayarepnina #annamariaserafimasergeevnaraevskayarepnina #раевскаярепнинааннамариясерафима #аннамариясерафимараевскаярепнина #раевскаярепнина #аннамариясерафимараевскаярепнина #раевскаярепнинааннамариясерафима #annamariaserafimaraevskayarepnina